PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03143.1.p
Common NameEUGRSUZ_F03143, LOC104449983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 397aa    MW: 43952.2 Da    PI: 6.3172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03143.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l++++  +G g+W++++++ g+ R++k+c++rw +yl
  Eucgr.F03143.1.p 14 RGLWSPEEDEKLINYISTYGHGCWSSVPKHAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding47.83.4e-1567109145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
  Eucgr.F03143.1.p  67 RGSFSQQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                       899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.395965IPR017930Myb domain
SuperFamilySSF466892.06E-2911108IPR009057Homeodomain-like
SMARTSM007171.1E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001675.50E-131761No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.30766116IPR017930Myb domain
PfamPF002497.7E-1467110IPR001005SANT/Myb domain
CDDcd001675.63E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIS TYGHGCWSSV PKHAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLMSHD  120
HHHHLHHHVI HNPYAADQEG FFSLLSNPSL ILASPGEDQV YFPTPNSTTA STLPHVMQNP  180
CQGNFEFDAP QQQEMPSFSL DHLVHYPHQI SHLSGNNLAS LYDQGLPFGH PLHQIIGPNQ  240
EDRPFTSEGA EHYADDGDNK IVDPDEILQS YDEYSPMVLG MPKLCEIMDG GFCNIPVTTS  300
SSSSSQEMLL DPLGAKLSAS SCLFLPTVSS SSCQEIYPPY IPTAINQMDC NNAIDASVMS  360
SSSSSSLVAD LSPSGPFGMN PSLTSTWRQQ TTLDSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-33141167108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03143.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062643.10.0PREDICTED: transcription repressor MYB4
TrEMBLA0A059BU200.0A0A059BU20_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s20370.15e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.27e-82myb domain protein 26